Mouse Anti-Rat E2f1 Antibody (MO-AB-25544H)
Cat: MO-AB-25544H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO25544C |
Specificity | This antibody binds to Rat E2f1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Nucleus; Cytoskeleton |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Transcriptional activator that binds to E2f sites. Required for wild-type growth in mitotic and polytene tissues, Contributes to the expression of replication genes at the G1-S transition and Cyclin E. Activates cell proliferation in wing imaginal disk, which requires expression of vg. |
Product Overview | This product is a mouse antibody against E2f1. It can be used for E2f1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Transcription factor E2F1; E2F-1; E2f1 |
UniProt ID | O09139 |
Protein Refseq | The length of the protein is 38 amino acids long. The sequence is show below: FLELLSHSADGVVDLNWAAEVLKVQKRRIYDITNVLEG. |
See other products for " E2f1 "
MO-NAB-00791W | Mouse Anti-Drosophila E2f1 Antibody (Full length) |
MO-AB-12535W | Mouse Anti-Chimpanzee E2F1 Antibody (MO-AB-12535W) |
CBMOAB-15442FYA | Mouse Anti-D. melanogaster E2F1 Antibody (CBMOAB-15442FYA) |
MO-AB-03150H | Mouse Anti-Frog e2f1 Antibody (MO-AB-03150H) |
MO-AB-01668Y | Mouse Anti-Chicken E2F1 Antibody (MO-AB-01668Y) |
CBMOAB-41380FYA | Mouse Anti-Rhesus E2F1 Antibody (CBMOAB-41380FYA) |
MO-NAB-00790W | Mouse Anti-Drosophila E2f1 Antibody (Full length) |
For Research Use Only | Not For Clinical Use.
Online Inquiry