Mouse Anti-Rat Kdm4b Antibody (MO-AB-26637H)


Cat: MO-AB-26637H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO26637C
SpecificityThis antibody binds to Rat Kdm4b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionHistone demethylase that specifically demethylates Lys-9 of histone H3, thereby playing a role in histone code. Does not demethylate histone H3 Lys-4, H3 Lys-27, H3 Lys-36 nor H4 Lys-20. Only able to demethylate trimethylated H3 Lys-9, with a weaker activity than KDM4A, KDM4C and KDM4D. Demethylation of Lys residue generates formaldehyde and succinate.
Product OverviewThis product is a mouse antibody against Kdm4b. It can be used for Kdm4b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSimilar to jumonji domain containing 2B; Kdm4b; LOC301128
UniProt IDQ4KM27
Protein RefseqThe length of the protein is 240 amino acids long.
The sequence is show below: MKRVSGACIQCSYEHCSTSFHVTCAHAAGVLMEPDDWPYVVSITCLKHRASGAGGQLLRTVSLGQIVITKNRNGLYYRCRVIGTTAQTFYEVNFDDGSYSDNLYPESITSRDCLRLGPPPEGELVELRWTDGNLYRARFISMATSLIYQVEFEDGSQLTVKRADIFTLEEELPKRVRSRLSLSTGTPQEPSFSGDGVKAAKRPRVATVLATTTEDTGRSPEYLAFMESLLQAQGQPGAPF.
For Research Use Only | Not For Clinical Use.
Online Inquiry