Mouse Anti-Rat Klhdc4 Antibody (MO-AB-26659H)
Cat: MO-AB-26659H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rat (Rattus norvegicus) |
Clone | MO26659C |
Specificity | This antibody binds to Rat Klhdc4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | KLHDC4 (Kelch Domain Containing 4) is a protein coding gene. Diseases associated with KLHDC4 include Huntington Disease-Like 2. |
Product Overview | This product is a mouse antibody against Klhdc4. It can be used for Klhdc4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein Klhdc4; RCG51065, isoform CRA_b; Klhdc4; RGD1561676 |
UniProt ID | D4A0L5 |
Protein Refseq | The length of the protein is 56 amino acids long. The sequence is show below: MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEPRDSSFTPSFPLLFGSACLPYCM. |
See other products for " KLHDC4 "
MO-AB-57924W | Mouse Anti-Marmoset KLHDC4 Antibody (MO-AB-57924W) |
MO-AB-04716H | Mouse Anti-Frog klhdc4 Antibody (MO-AB-04716H) |
CBMOAB-46476FYA | Mouse Anti-Rhesus KLHDC4 Antibody (CBMOAB-46476FYA) |
CBMOAB-63993FYA | Mouse Anti-Zebrafish klhdc4 Antibody (CBMOAB-63993FYA) |
MO-AB-17817W | Mouse Anti-Chimpanzee KLHDC4 Antibody (MO-AB-17817W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry