Mouse Anti-Rat Mia Antibody (MO-AB-27084H)


Cat: MO-AB-27084H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27084C
SpecificityThis antibody binds to Rat Mia.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMIA (Melanoma Inhibitory Activity) is a protein coding gene. Diseases associated with MIA include Melanoma and Skin Melanoma. Among its related pathways are Neural Crest Differentiation. Gene Ontology (GO) annotations related to this gene include growth factor activity. An important paralog of this gene is MIA-RAB4B.
Product OverviewThis product is a mouse antibody against Mia. It can be used for Mia detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMelanoma-derived growth regulatory protein; Cartilage-derived retinoic acid-sensitive protein; CD-RAP; Melanoma inhibitory activity protein; Mia; Cdrap Mia1
UniProt IDQ62946
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: MVCSPVLLGIVILSVFSGLSRADRAMPKLADRKLCADEECSHPISMAVALQDYVAPDCRFLTIYRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAAHLGYFPSSIVREDLTLKPGKVDMKTDEWDFYCQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry