Mouse Anti-Rat Msrb3 Antibody (MO-AB-27271H)


Cat: MO-AB-27271H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27271C
SpecificityThis antibody binds to Rat Msrb3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndoplasmic reticulum; Other locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula.
Product OverviewThis product is a mouse antibody against Msrb3. It can be used for Msrb3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProtein Msrb3; Msrb3; LOC680036
UniProt IDD4A650
Protein RefseqThe length of the protein is 203 amino acids long.
The sequence is show below: AVAAAFASGCVAEDTTAMSAFNLLHLVTKSQPVALRACGLPSGSSRDKKNCKVAFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVISSEAIEFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSASLSFTPADSGEAEGGGSKESSSPAAADRAEL.
For Research Use Only | Not For Clinical Use.
Online Inquiry