Mouse Anti-Rat Nudt5 Antibody (MO-AB-27612H)


Cat: MO-AB-27612H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27612C
SpecificityThis antibody binds to Rat Nudt5.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the Nudix (nucleoside diphosphate linked moiety X) hydrolase superfamily. The encoded enzyme catalyzes the hydrolysis of modified nucleoside diphosphates, including ADP-ribose (ADPR) and 8-oxoGua-containing 8-oxo-dADP and 8-oxo-dGDP. Protein-bound ADP ribose can be hazardous to the cell because it can modify some amino acid residues, resulting in the inhibition of ATP-activated potassium channels. 8-oxoGua is an oxidized form of guanine that can potentially alter genetic information by pairing with adenine and cytosine in RNA. Presence of 8-oxoGua in RNA results in formation of abnormal proteins due to translational errors.
Product OverviewThis product is a mouse antibody against Nudt5. It can be used for Nudt5 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesADP-sugar pyrophosphatase; EC 3.6.1.13; 8-oxo-dGDP phosphatase; EC 3.6.1.58; Nucleoside diphosphate-linked moiety X motif 5; Nudix motif 5; Nudt5
UniProt IDQ6AY63
Protein RefseqThe length of the protein is 219 amino acids long.
The sequence is show below: METQEPKDSSPPTEQRILSEELISEGKWVKFEKTTYMDPTGKTRTWETVKLTTRKGKSADAVSVIPVLQRTLHHECIVLVKQFRPPMGGYCLEFPAGLIEDGESPEAAALRELEEETGYKGDIAECSPAVCMDPGLSNCTTHVVTVTINGDDAGNVRPKPKPGDGEFVEVISLPKNDLLTRLDALGAEDRLTVDARVYAYALALKHANAKPFEVPFLKF.
For Research Use Only | Not For Clinical Use.
Online Inquiry