Mouse Anti-Rat Parp2 Antibody (MO-AB-27726H)


Cat: MO-AB-27726H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27726C
SpecificityThis antibody binds to Rat Parp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes poly(ADP-ribosyl)transferase-like 2 protein, which contains a catalytic domain and is capable of catalyzing a poly(ADP-ribosyl)ation reaction. This protein has a catalytic domain which is homologous to that of poly (ADP-ribosyl) transferase, but lacks an N-terminal DNA binding domain which activates the C-terminal catalytic domain of poly (ADP-ribosyl) transferase. The basic residues within the N-terminal region of this protein may bear potential DNA-binding properties, and may be involved in the nuclear and/or nucleolar targeting of the protein. Two alternatively spliced transcript variants encoding distinct isoforms have been found.
Product OverviewThis product is a mouse antibody against Parp2. It can be used for Parp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesParp2 protein; Parp2
UniProt IDB1WC20
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MAPRRRRSGCGRRVLNEAKRVDNGNRATDDSPPGKKVRTCQKKGPAAGGEDTDRTKGKQDSVKTLLVKGRAPVDPECTSKVGKAHVYCEGDDVYDVMLNQTNLQFNNNKYYLIQLLEDDAQQNFSVWMRWGRGKGFMMD.
See other products for " PARP2 "
CBMOAB-38138FYCMouse Anti-Arabidopsis PARP2 Antibody (CBMOAB-38138FYC)
MO-AB-06023HMouse Anti-Frog parp2 Antibody (MO-AB-06023H)
MO-AB-11020WMouse Anti-Chimpanzee PARP2 Antibody (MO-AB-11020W)
MO-DKB-0359RARabbit Anti-PARP2 Antibody (MO-DKB-0359RA)
CBMOAB-53915FYAMouse Anti-Rhesus PARP2 Antibody (CBMOAB-53915FYA)
CBMOAB-91460FYAMouse Anti-Zebrafish parp2 Antibody (CBMOAB-91460FYA)
MO-DKB-01691WRabbit Anti-PARP2 Antibody (MO-DKB-01691W)
MO-AB-05002WMouse Anti-Rhesus PARP2 Antibody (MO-AB-05002W)
MO-DKB-02572WRabbit Anti-PARP2 Antibody (MO-DKB-02572W)
For Research Use Only | Not For Clinical Use.
Online Inquiry