Mouse Anti-Rat Per1 Antibody (MO-AB-27812H)


Cat: MO-AB-27812H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27812C
SpecificityThis antibody binds to Rat Per1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the Period family of genes and is expressed in a circadian pattern in the suprachiasmatic nucleus, the primary circadian pacemaker in the mammalian brain. Genes in this family encode components of the circadian rhythms of locomotor activity, metabolism, and behavior. This gene is upregulated by CLOCK/ARNTL heterodimers but then represses this upregulation in a feedback loop using PER/CRY heterodimers to interact with CLOCK/ARNTL. Polymorphisms in this gene may increase the risk of getting certain cancers. Alternative splicing has been observed in this gene; however, these variants have not been fully described.
Product OverviewThis product is a mouse antibody against Per1. It can be used for Per1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesPer1 protein; Per1
UniProt IDQ498T1
Protein RefseqThe length of the protein is 164 amino acids long.
The sequence is show below: MANADQHVMMTYQVPSRDAASVLKQDRERLRAMQKQQPRFSEDQRRELGAVHSWVRKGQLPQALDVTACVDCGSSVQDPGHSDDPLFSELDGLGLEPMEEGGGEGGGVGGGGGGVGGGGGDGGEEAQTQIGTKGSSSQDSAMEEEEQGGSSSSPALPAEENGTS.
For Research Use Only | Not For Clinical Use.
Online Inquiry