Mouse Anti-Rat Pip Antibody (MO-AB-27886H)


Cat: MO-AB-27886H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27886C
SpecificityThis antibody binds to Rat Pip.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Plasma membrane; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionSulfotransferase involved in dorsoventral axis patterning in early embryos. Required for the specific ventral activation of a series of proteases acting in the perivitelline space between the embryonic membrane and the eggshell. Probably acts by mediating the sulfation of some glycoprotein or glycosaminoglycan stably deposited in the egg, whose ventrally localized modification leads to spatially restricted activation of the protease cascade.
Product OverviewThis product is a mouse antibody against Pip. It can be used for Pip detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProlactin-inducible protein homolog; Prolactin-induced protein; Pip
UniProt IDO70417
Protein RefseqThe length of the protein is 146 amino acids long.
The sequence is show below: MQGLSFTSTAATFFLVLCLQLGINEGQDNETIPQPLLFQLNVPSTPDENQEVDMSLTLQTQYKECLVVKAYLISNTPVDGGFNYIQTRCICNDHPTTLYWTFVVTQTLTFRIMVDIVKDKGICPNNVAVVPISGNRYFTDRTVYVN.
See other products for " PIP "
MO-AB-26864WMouse Anti-Chimpanzee PIP Antibody (MO-AB-26864W)
MO-AB-32245HMouse Anti-Soybean PIP Antibody (MO-AB-32245H)
MO-AB-09347YMouse Anti-Rabbit PIP Antibody (MO-AB-09347Y)
CBMOAB-54576FYAMouse Anti-Rhesus PIP Antibody (CBMOAB-54576FYA)
MO-DKB-0382RARabbit Anti-PIP Antibody (MO-DKB-0382RA)
MO-AB-17947RMouse Anti-Cattle PIP Antibody (MO-AB-17947R)
CBMOAB-27750FYAMouse Anti-D. melanogaster Pip Antibody (CBMOAB-27750FYA)
CBMOAB-38883FYCMouse Anti-Arabidopsis PIP Antibody (CBMOAB-38883FYC)
For Research Use Only | Not For Clinical Use.
Online Inquiry