Mouse Anti-Rat Rbp2 Antibody (MO-AB-28381H)


Cat: MO-AB-28381H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO28381C
SpecificityThis antibody binds to Rat Rbp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Product OverviewThis product is a mouse antibody against Rbp2. It can be used for Rbp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRetinol-binding protein 2; Cellular retinol-binding protein II; CRBP-II; Rbp2; Crbpii
UniProt IDP06768
Protein RefseqThe length of the protein is 134 amino acids long.
The sequence is show below: MTKDQNGTWEMESNENFEGYMKALDIDFATRKIAVRLTQTKIIVQDGDNFKTKTNSTFRNYDLDFTVGVEFDEHTKGLDGRNVKTLVTWEGNTLVCVQKGEKENRGWKQWVEGDKLYLELTCGDQVCRQVFKKK.
For Research Use Only | Not For Clinical Use.
Online Inquiry