Mouse Anti-Rat Rida Antibody (MO-AB-28505H)


Cat: MO-AB-28505H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO28505C
SpecificityThis antibody binds to Rat Rida.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPeroxisome; Other locations; Cytosol; Nucleus; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAccelerates the release of ammonia from reactive enamine/imine intermediates of the PLP-dependent threonine dehydratase (IlvA) in the low water environment of the cell. It catalyzes the deamination of enamine/imine intermediates to yield 2-ketobutyrate and ammonia. It is required for the detoxification of reactive intermediates of IlvA due to their highly nucleophilic abilities. Involved in the isoleucine biosynthesis (By similarity).
Product OverviewThis product is a mouse antibody against Rida. It can be used for Rida detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRibonuclease UK114; 14.5 kDa translational inhibitor protein; Perchloric acid soluble protein; Hrsp12; Psp1
UniProt IDP52759
Protein RefseqThe length of the protein is 137 amino acids long.
The sequence is show below: MSSIIRKVISTSKAPAAIGAYSQAVLVDRTIYVSGQIGMDPSSGQLVPGGVAEEAKQALKNLGEILKAAGCDFTNVVKTTVLLADINDFGTVNEIYKTYFQGNLPARAAYQVAALPKGSRIEIEAIAVQGPFTTAGL.
For Research Use Only | Not For Clinical Use.
Online Inquiry