Mouse Anti-Rat Ssb Antibody (MO-AB-29220H)


Cat: MO-AB-29220H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO29220C
SpecificityThis antibody binds to Rat Ssb.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is involved in diverse aspects of RNA metabolism, including binding and protecting poly(U) termini of nascent RNA polymerase III transcripts from exonuclease digestion, processing 5' and 3' ends of pre-tRNA precursors, acting as an RNA chaperone, and binding viral RNAs associated with hepatitis C virus. Autoantibodies reacting with this protein are found in the sera of patients with Sjogren syndrome and systemic lupus erythematosus. Alternative promoter usage results in two different transcript variants which encode the same protein.
Product OverviewThis product is a mouse antibody against Ssb. It can be used for Ssb detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSsb protein; Ssb
UniProt IDQ4V8Q3
Protein RefseqThe length of the protein is 152 amino acids long.
The sequence is show below: MAENGDNEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLETMIKFNRLNRLTTDFNVIVQALSKSKANLMEVSADKTKIRRSPSRPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLDDKGQILNIQMRRTLHKTFKV.
For Research Use Only | Not For Clinical Use.
Online Inquiry