Mouse Anti-Rat Sumo1 Antibody (MO-AB-29284H)


Cat: MO-AB-29284H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO29284C
SpecificityThis antibody binds to Rat Sumo1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUbiquitin-like protein which can be covalently attached to target lysines as a monomer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Required for the massive protein sumoylation in the nucleus induced by heat shock and controlled by SIZ1. Involved in the regulation of the heat stress transcription factor HSFA2 in acquired thermotolerance.
Product OverviewThis product is a mouse antibody against Sumo1. It can be used for Sumo1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSmall ubiquitin-related modifier 1; SUMO-1; Sumo1
UniProt IDQ5I0H3
Protein RefseqThe length of the protein is 101 amino acids long.
The sequence is show below: MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV.
For Research Use Only | Not For Clinical Use.
Online Inquiry