Mouse Anti-RBM11 Antibody (CBMOAB-56161FYA)


Cat: CBMOAB-56161FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-56161FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus) WB, ELISA MO56161FYA 100 µg
MO-AB-06962H Monoclonal Frog (Xenopus laevis) WB, ELISA MO06962C 100 µg
MO-AB-19097R Monoclonal Cattle (Bos taurus) WB, ELISA MO19097R 100 µg
MO-AB-28368H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28368C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Rat (Rattus norvegicus)
CloneMO56161FYA
SpecificityThis antibody binds to Rhesus RBM11.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus RBM11 Antibody is a mouse antibody against RBM11. It can be used for RBM11 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRBM11
UniProt IDF7GP43
Protein RefseqThe length of the protein is 167 amino acids long.
The sequence is show below: MVVGRSSFPMQCLPIHNTSLPQEYFPFQKMQWHAYNPVLQLPYYEMTAPLPNSASVSSSLNHVPDLEAGPSSYKWTHQQPGDSDLYQMTAPLPSSASVSSSLNHVPDLEAGPTSYKWTHQQPSDSDFYQMNKRKRQKQTSDSDSSTDNNRGNECSQKFRKSKKKKRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry