AibGenesis™ Mouse Anti-rbm18 Antibody (CBMOAB-95437FYA)


Cat: CBMOAB-95437FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-95437FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus) WB, ELISA MO95437FYA 100 µg
MO-AB-17588W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO17588W 100 µg
MO-AB-19104R Monoclonal Cattle (Bos taurus) WB, ELISA MO19104R 100 µg
MO-AB-28370H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28370C 100 µg
MO-AB-63054W Monoclonal Marmoset WB, ELISA MO63054W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Marmoset, Rat (Rattus norvegicus)
CloneMO95437FYA
SpecificityThis antibody binds to Zebrafish rbm18.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Zebrafish rbm18 Antibody is a mouse antibody against rbm18. It can be used for rbm18 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesProbable RNA-binding protein 18; RNA-binding motif protein 18; rbm1
UniProt IDQ6PBM8
Protein RefseqThe length of the protein is 188 amino acids long.
The sequence is show below: MQSAAETVENASILSGGSAQDGHRLWIGNIDPKITEYHLVKLLEKFGKVKQFDFLFHKSGPLEGQPRGYCFVNFHTKEEAERAIQCLNGKLALSKKLVVRWAHAQRFEPFRGEKNMPASLEPSSSEAEDLPTSLSVNAKIRAIEAKLQMMEENPDDYSGPSAYTYNKPPDKREKRSQPYHKHFRKHRR.
For Research Use Only | Not For Clinical Use.
Online Inquiry