Mouse Anti-Rbp2 Antibody (CBMOAB-28838FYA)


Cat: CBMOAB-28838FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-28838FYA Monoclonal Fruit fly (Drosophila melanogaster), Barrel medic (Medicago truncatula), Cattle (Bos taurus), Chicken (Gallus gallus), Pig (Sus scrofa), Rat (Rattus norvegicus), Silkworm (Bombyx mori) WB, ELISA MO28838FYA 100 µg
MO-AB-00534W Monoclonal Barrel medic (Medicago truncatula) WB, ELISA MO00534W 100 µg
MO-AB-03703Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03703Y 100 µg
MO-AB-19133R Monoclonal Cattle (Bos taurus) WB, ELISA MO19133R 100 µg
MO-AB-28381H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28381C 100 µg
MO-AB-28765R Monoclonal Pig (Sus scrofa) WB, ELISA MO28765R 100 µg
MO-AB-70288W Monoclonal Silkworm (Bombyx mori) WB, ELISA MO70288W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster), Barrel medic (Medicago truncatula), Cattle (Bos taurus), Chicken (Gallus gallus), Pig (Sus scrofa), Rat (Rattus norvegicus), Silkworm (Bombyx mori)
CloneMO28838FYA
SpecificityThis antibody binds to fruit fly Rbp2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an abundant protein present in the small intestinal epithelium. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues, and vision. This protein may also modulate the supply of retinoic acid to the nuclei of endometrial cells during the menstrual cycle.
Product OverviewMouse Anti-D. melanogaster Rbp2 Antibody is a mouse antibody against Rbp2. It can be used for Rbp2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRNA-binding protein 2, isoform D; Rbp2
UniProt IDX2JC79
Protein RefseqThe length of the protein is 388 amino acids long.
The sequence is show below: MAGRGGYEHARSGFGGDRASKQLPTEPPFIAFVGNLPQGLVQGDVIKIFQDFEVKYVRLVKDRETDQFKGFCYVEFETLDNLERALECDGRIKLDDLSAPLRIDIADRRKNDRPGGGVGGGNGGMTRGDGGRDGFQKRGPPRQGGSSQSYSRGGPGTGGGGREGGGGSGNRGDSRGSYIDSYGGHNDRSRGVGGSGAGSGGGMNRGYNDRPANRGRYGSFNNDDRPFERNQDRDRGQREGSYGNQSRDGDRYNNFNRHRDRERTHYNPNQQSERPSGGMTGLGGGSGGSGGLGVGGGSSMGAIDNFRHFKKPISRIISNMCQSRVSQLAVPRTNDNERPRLQLKPRTIAAPINAVAETKQSASIFGNAKPREEKLKELQQNVNHNGDN.
For Research Use Only | Not For Clinical Use.
Online Inquiry