Mouse Anti-rgs20 Antibody (MO-AB-07089H)


Cat: MO-AB-07089H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-07089H Monoclonal Frog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio) WB, ELISA MO07089C 100 µg
CBMOAB-56425FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO56425FYA 100 µg
CBMOAB-95840FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO95840FYA 100 µg
MO-AB-05642W Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO05642W 100 µg
MO-AB-63256W Monoclonal Marmoset WB, ELISA MO63256W 100 µg
MO-AB-19241R Monoclonal Cattle (Bos taurus) WB, ELISA MO19241R 100 µg
MO-AB-28461H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO28461C 100 µg
MO-AB-03803Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO03803Y 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis), Cattle (Bos taurus), Chicken (Gallus gallus), Marmoset, Rat (Rattus norvegicus), Rhesus (Macaca mulatta), Zebrafish (Danio rerio)
CloneMO07089C
SpecificityThis antibody binds to Frog rgs20.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the family of regulator of G protein signaling (RGS) proteins, which are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins inhibit signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound forms. This protein selectively binds to G(z)-alpha and G(alpha)-i2 subunits, and regulates their signaling activities. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewThis product is a mouse antibody against rgs20. It can be used for rgs20 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRgs20-prov protein; rgs20; rgs20-prov
UniProt IDQ6DDG9
Protein RefseqThe length of the protein is 253 amino acids long.
The sequence is show below: MEDDEQPALGEQPSFNGCDQGKDLQLPPSVDGEIPMGSERMEMRKRQMSVHQETVSGTQAQQGVGNRGSNACCFCWCCCCSCSCLTVRNQDDERTRRSSNEIRGHGIPNWEESPSPTLEDVYSWGQSFDKLMTTPAGRNAFREFLRTEFSEENMLFWMACEDLKKEASKNVIEEKARLIYEDYISILSPKEVSLDSRVREVINRNMLEPSQCTFDDAQLQIYTLMHRDSYPRFMNSAIYKNLLQSLSESPAES.
For Research Use Only | Not For Clinical Use.
Online Inquiry