Mouse Anti-Rhesus AAMP Antibody (CBMOAB-34760FYA)


Cat: CBMOAB-34760FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34760FYA
SpecificityThis antibody binds to Rhesus AAMP.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytoskeleton; Extracellular region or secreted; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe gene is a member of the immunoglobulin superfamily. The encoded protein is associated with angiogenesis, with potential roles in endothelial tube formation and the migration of endothelial cells. It may also regulate smooth muscle cell migration via the RhoA pathway. The encoded protein can bind to heparin and may mediate heparin-sensitive cell adhesion.
Product OverviewMouse Anti-Rhesus AAMP (clone MO34760FYA) Antibody (CBMOAB-34760FYA) is a mouse antibody against AAMP. It can be used for AAMP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAAMP
UniProt IDF7CR28
Protein RefseqThe length of the protein is 347 amino acids long.
The sequence is show below: MESESESGAAADTPPLETLSFHGDEEIIEVVELDPGPPDPDDLAQEMEDVDFEEEEEEEGNEEGWVLEPQEGVVGSMEGPDDSEVTFALHSASVFCVSLDPKTNTLAVTGGEDDKAFVWRLSDGELLFECAGHKDSVTCAGFSHDSTLVATGDMSGLLKVWQVDTKEEVWSFEAGDLEWMEWHPRAPVLLAGTADGNTWMWKVPNGDCKTFQGPNCPATCGRVLPDGKRAVVGYEDGTIRIWDLKQGSPIHVLKGTEGHQGPLTCVATNQDGSLILTGSVDCQAKLVSATTGKVSGPGARLGPPLSRLLSFLPGSSLSPLPTVFLSIKHPDSGPSSDPLWLSGGGCF.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry