Mouse Anti-Rhesus ABCA9 Antibody (CBMOAB-34799FYA)


Cat: CBMOAB-34799FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34799FYA
SpecificityThis antibody binds to Rhesus ABCA9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the superfamily of ATP-binding cassette (ABC) transporters and the encoded protein contains two transmembrane domains and two nucleotide binding folds. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This gene is a member of the ABC1 subfamily and is clustered with four other ABC1 family members on chromosome 17q24. Transcriptional expression of this gene is induced during monocyte differentiation into macrophages and is suppressed by cholesterol import.
Product OverviewMouse Anti-Rhesus ABCA9 Antibody is a mouse antibody against ABCA9. It can be used for ABCA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP-binding cassette sub-family A member 9; ABCA9
UniProt IDH9F5Z0
Protein RefseqThe length of the protein is 81 amino acids long.
The sequence is show below: RQERFSSLMVYKLPVEDVRPLSQAFFKLEIVKQNFDLEEYSLSQSTLEQVFLELAKEQELGDLEDDFDPSVKWKLIPQEEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry