Mouse Anti-Rhesus ABCA9 Antibody (CBMOAB-34799FYA)
Cat: CBMOAB-34799FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO34799FYA |
Specificity | This antibody binds to Rhesus ABCA9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the superfamily of ATP-binding cassette (ABC) transporters and the encoded protein contains two transmembrane domains and two nucleotide binding folds. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White). This gene is a member of the ABC1 subfamily and is clustered with four other ABC1 family members on chromosome 17q24. Transcriptional expression of this gene is induced during monocyte differentiation into macrophages and is suppressed by cholesterol import. |
Product Overview | Mouse Anti-Rhesus ABCA9 Antibody is a mouse antibody against ABCA9. It can be used for ABCA9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ATP-binding cassette sub-family A member 9; ABCA9 |
UniProt ID | H9F5Z0 |
Protein Refseq | The length of the protein is 81 amino acids long. The sequence is show below: RQERFSSLMVYKLPVEDVRPLSQAFFKLEIVKQNFDLEEYSLSQSTLEQVFLELAKEQELGDLEDDFDPSVKWKLIPQEEP. |
See other products for " Abca9 "
MO-AB-23935H | Mouse Anti-Rat Abca9 Antibody (MO-AB-23935H) |
MO-AB-24033W | Mouse Anti-Chimpanzee ABCA9 Antibody (MO-AB-24033W) |
CBMOAB-1260FYC | Mouse Anti-Arabidopsis ABCA9 Antibody (CBMOAB-1260FYC) |
MO-AB-06750R | Mouse Anti-Cattle ABCA9 Antibody (MO-AB-06750R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry