Mouse Anti-Rhesus ACRV1 Antibody (CBMOAB-34993FYA)


Cat: CBMOAB-34993FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO34993FYA
SpecificityThis antibody binds to Rhesus ACRV1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration. Alternatively spliced transcript variants have been described.
Product OverviewMouse Anti-Rhesus ACRV1 Antibody is a mouse antibody against ACRV1. It can be used for ACRV1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACRV1
UniProt IDF6VYE7
Protein RefseqThe length of the protein is 246 amino acids long.
The sequence is show below: MNMLLLLMSLYLLGSARGTSGHSDESSGSIDHQTSVQQLSGEFFSLENPSDAEALYETASGLNTLSEHGSSEHGSREHTVAEHTPGEHAESEHASGEPAATGHAEGEHTVGEQPSGEQSSGEHLSGEQPLGEHASGEQPSDEQLSGEHASGEQPSGEHASGEQPSGTILNCYTCAYMNDQGRCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI.
See other products for " ACRV1 "
MO-AB-23494RMouse Anti-Pig ACRV1 Antibody (MO-AB-23494R)
MO-AB-06917RMouse Anti-Cattle ACRV1 Antibody (MO-AB-06917R)
For Research Use Only | Not For Clinical Use.
Online Inquiry