Mouse Anti-Rhesus ACTA1 Antibody (CBMOAB-35019FYA)
Cat: CBMOAB-35019FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO35019FYA |
| Specificity | This antibody binds to Rhesus ACTA1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The product encoded by this gene belongs to the actin family of proteins, which are highly conserved proteins that play a role in cell motility, structure and integrity. Alpha, beta and gamma actin isoforms have been identified, with alpha actins being a major constituent of the contractile apparatus, while beta and gamma actins are involved in the regulation of cell motility. This actin is an alpha actin that is found in skeletal muscle. Mutations in this gene cause nemaline myopathy type 3, congenital myopathy with excess of thin myofilaments, congenital myopathy with cores, and congenital myopathy with fiber-type disproportion, diseases that lead to muscle fiber defects. |
| Product Overview | Mouse Anti-Rhesus ACTA1 Antibody is a mouse antibody against ACTA1. It can be used for ACTA1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Actin, alpha skeletal muscle; ACTA1 |
| UniProt ID | H9FLM8 |
| Protein Refseq | The length of the protein is 82 amino acids long. The sequence is show below: ITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVMSGGTTMYPGIADRMQKEITALAPSTMKIKI. |
See other products for " acta1 "
| CBMOAB-64749FYA | Mouse Anti-Zebrafish acta1 Antibody (CBMOAB-64749FYA) |
| MO-NAB-00095W | Mouse Anti-Zebrafish ACTA1 Antibody (MO-NAB-00095W) |
| MO-NAB-00469W | Rabbit Anti-ACTA1 Antibody |
| MO-AB-43564W | Mouse Anti-Horse ACTA1 Antibody (MO-AB-43564W) |
| MO-DKB-00323W | Rabbit Anti-Acta1 Antibody (MO-DKB-00323W) |
| MO-NAB-00548W | Mouse Anti-ACTA1 Antibody |
| MO-AB-01199H | Mouse Anti-Frog acta1 Antibody (MO-AB-01199H) |
| MO-AB-07069Y | Mouse Anti-Rabbit ACTA1 Antibody (MO-AB-07069Y) |
| MO-AB-06935R | Mouse Anti-Cattle ACTA1 Antibody (MO-AB-06935R) |
| MO-NAB-00390W | Rabbit Anti-ACTA1 Antibody (AA 40-80) |
For Research Use Only | Not For Clinical Use.
Online Inquiry