Mouse Anti-Rhesus ACY3 Antibody (CBMOAB-35060FYA)
Cat: CBMOAB-35060FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO35060FYA |
Specificity | This antibody binds to Rhesus ACY3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Plays an important role in deacetylating mercapturic acids in kidney proximal tubules. Also acts on N-acetyl-aromatic amino acids (By similarity). |
Product Overview | Mouse Anti-Rhesus ACY3 Antibody is a mouse antibody against ACY3. It can be used for ACY3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Aspartoacylase-2; ACY3 |
UniProt ID | H9F319 |
Protein Refseq | The length of the protein is 52 amino acids long. The sequence is show below: EDLLYDGESTVYPVFINEAAYYEKGIAFVQTEKFTFTVPAMPVLNPAPSPAS. |
See other products for " ACY3 "
MO-AB-50416W | Mouse Anti-Marmoset ACY3 Antibody (MO-AB-50416W) |
MO-AB-14548W | Mouse Anti-Chimpanzee ACY3 Antibody (MO-AB-14548W) |
CBMOAB-00369HCB | Mouse Anti-C. elegans ACY3 Antibody (CBMOAB-00369HCB) |
For Research Use Only | Not For Clinical Use.
Online Inquiry