Mouse Anti-Rhesus ACYP2 Antibody (CBMOAB-35065FYA)


Cat: CBMOAB-35065FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35065FYA
SpecificityThis antibody binds to Rhesus ACYP2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionAcylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene.
Product OverviewMouse Anti-Rhesus ACYP2 Antibody is a mouse antibody against ACYP2. It can be used for ACYP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesACYP2
UniProt IDF6UFR3
Protein RefseqThe length of the protein is 80 amino acids long.
The sequence is show below: GVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKIGSPSSRIDRTNFSNEKTISKLEYSNFSIRY.
For Research Use Only | Not For Clinical Use.
Online Inquiry