Mouse Anti-Rhesus ACYP2 Antibody (CBMOAB-35065FYA)
Cat: CBMOAB-35065FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO35065FYA |
Specificity | This antibody binds to Rhesus ACYP2. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Acylphosphatase can hydrolyze the phosphoenzyme intermediate of different membrane pumps, particularly the Ca2+/Mg2+-ATPase from sarcoplasmic reticulum of skeletal muscle. Two isoenzymes have been isolated, called muscle acylphosphatase and erythrocyte acylphosphatase on the basis of their tissue localization. This gene encodes the muscle-type isoform (MT). An increase of the MT isoform is associated with muscle differentiation. Several transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Rhesus ACYP2 Antibody is a mouse antibody against ACYP2. It can be used for ACYP2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | ACYP2 |
UniProt ID | F6UFR3 |
Protein Refseq | The length of the protein is 80 amino acids long. The sequence is show below: GVCFRMYTEDEARKIGVVGWVKNTSKGTVTGQVQGPEDKVNSMKSWLSKIGSPSSRIDRTNFSNEKTISKLEYSNFSIRY. |
See other products for " ACYP2 "
MO-AB-50419W | Mouse Anti-Marmoset ACYP2 Antibody (MO-AB-50419W) |
MO-AB-23522R | Mouse Anti-Pig ACYP2 Antibody (MO-AB-23522R) |
MO-AB-32807H | Mouse Anti-Nile tilapia ACYP2 Antibody (MO-AB-32807H) |
MO-AB-28811W | Mouse Anti-Dog ACYP2 Antibody (MO-AB-28811W) |
CBMOAB-00673FYA | Mouse Anti-D. melanogaster Acyp2 Antibody (CBMOAB-00673FYA) |
MO-AB-23968H | Mouse Anti-Rat Acyp2 Antibody (MO-AB-23968H) |
MO-AB-14525W | Mouse Anti-Chimpanzee ACYP2 Antibody (MO-AB-14525W) |
MO-AB-06981R | Mouse Anti-Cattle ACYP2 Antibody (MO-AB-06981R) |
MO-AB-41171W | Mouse Anti-Guinea pig ACYP2 Antibody (MO-AB-41171W) |
MO-AB-07075Y | Mouse Anti-Rabbit ACYP2 Antibody (MO-AB-07075Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry