Mouse Anti-Rhesus ADAM33 Antibody (CBMOAB-35115FYA)
Cat: CBMOAB-35115FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO35115FYA |
| Specificity | This antibody binds to Rhesus ADAM33. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Product Overview | Mouse Anti-Rhesus ADAM33 Antibody is a mouse antibody against ADAM33. It can be used for ADAM33 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Disintegrin and metalloproteinase domain-containing protein 33 isoform alpha preproprotein; ADAM33 |
| UniProt ID | H9FCS2 |
| Protein Refseq | The length of the protein is 83 amino acids long. The sequence is show below: GKLQCQGGKPSLLTPHMVPVDSTVHLDGHEVTCRGVLALPGAQLDLLGLGMVEPGTQCGPRMVCQSRRCENTAFQELHRCLTA. |
See other products for " ADAM33 "
| MO-AB-03340W | Mouse Anti-Rhesus ADAM33 Antibody (MO-AB-03340W) |
| MO-AB-01232H | Mouse Anti-Frog adam33 Antibody (MO-AB-01232H) |
| MO-AB-06996R | Mouse Anti-Cattle ADAM33 Antibody (MO-AB-06996R) |
| MO-AB-18566W | Mouse Anti-Chimpanzee ADAM33 Antibody (MO-AB-18566W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry