Mouse Anti-Rhesus ADAM8 Antibody (MO-AB-00938W)


Cat: MO-AB-00938W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO00938W
SpecificityThis antibody binds to Rhesus ADAM8.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene may be involved in cell adhesion during neurodegeneration, and it is thought to be a target for allergic respiratory diseases, including asthma. Alternative splicing results in multiple transcript variants. (From NCBI)
Product OverviewMouse Anti-Rhesus ADAM8 Antibody is a mouse antibody against ADAM8. It can be used for ADAM8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDisintegrin and metalloproteinase domain-containing protein 8 isoform 2; ADAM8
UniProt IDH9F242
Protein RefseqThe length of the protein is 48 amino acids long.
The sequence is show below: CSSGHCVQATLPSSCLCPAGTKAGHQADIRAPSTPSQTRGWCDQAWSS.
For Research Use Only | Not For Clinical Use.
Online Inquiry