Mouse Anti-Rhesus ADAM8 Antibody (MO-AB-00938W)
Cat: MO-AB-00938W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO00938W |
| Specificity | This antibody binds to Rhesus ADAM8. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene may be involved in cell adhesion during neurodegeneration, and it is thought to be a target for allergic respiratory diseases, including asthma. Alternative splicing results in multiple transcript variants. |
| Product Overview | Mouse Anti-Rhesus ADAM8 Antibody is a mouse antibody against ADAM8. It can be used for ADAM8 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Disintegrin and metalloproteinase domain-containing protein 8 isoform 2; ADAM8 |
| UniProt ID | H9F242 |
| Protein Refseq | The length of the protein is 48 amino acids long. The sequence is show below: CSSGHCVQATLPSSCLCPAGTKAGHQADIRAPSTPSQTRGWCDQAWSS. |
See other products for " ADAM8 "
| MO-AB-23528R | Mouse Anti-Pig ADAM8 Antibody (MO-AB-23528R) |
| CBMOAB-35117FYA | Mouse Anti-Rhesus ADAM8 Antibody (CBMOAB-35117FYA) |
For Research Use Only | Not For Clinical Use.
Online Inquiry