Mouse Anti-ADORA2A Antibody (CBMOAB-35231FYA)


Cat: CBMOAB-35231FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35231FYA Monoclonal Rhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries) WB, ELISA MO35231FYA 100 µg
MO-AB-00015L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00015L 100 µg
MO-AB-00060Y Monoclonal Chicken (Gallus gallus) WB, ELISA MO00060Y 100 µg
MO-AB-01267H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01267C 100 µg
MO-AB-07062R Monoclonal Cattle (Bos taurus) WB, ELISA MO07062R 100 µg
MO-AB-07096Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07096Y 100 µg
MO-AB-08903W Monoclonal Cat (Felis catus) WB, ELISA MO08903W 100 µg
MO-AB-14097Y Monoclonal Sheep (Ovis aries) WB, ELISA MO14097Y 100 µg
MO-AB-21531W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21531W 100 µg
MO-AB-23578R Monoclonal Pig (Sus scrofa) WB, ELISA MO23578R 100 µg
MO-AB-28841W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO28841W 100 µg
MO-AB-32808H Monoclonal Nile tilapia (Oreochromis niloticus) WB, ELISA MO32808C 100 µg
MO-AB-34338W Monoclonal Ferret (Mustela Putorius Furo) WB, ELISA MO34338W 100 µg
MO-AB-41180W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41180W 100 µg
MO-AB-43588W Monoclonal Horse (Equus caballus) WB, ELISA MO43588W 100 µg
MO-AB-50511W Monoclonal Marmoset WB, ELISA MO50511W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cat (Felis catus), Cattle (Bos taurus), Chicken (Gallus gallus), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Elephant (Loxodonta africana), Ferret (Mustela Putorius Furo), Frog (Xenopus laevis), Guinea pig (Cavia porcellus), Horse (Equus caballus), Marmoset, Nile tilapia (Oreochromis niloticus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Sheep (Ovis aries)
CloneMO35231FYA
SpecificityThis antibody binds to Rhesus ADORA2A.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor (GPCR) superfamily, which is subdivided into classes and subtypes. The receptors are seven-pass transmembrane proteins that respond to extracellular cues and activate intracellular signal transduction pathways. This protein, an adenosine receptor of A2A subtype, uses adenosine as the preferred endogenous agonist and preferentially interacts with the G(s) and G(olf) family of G proteins to increase intracellular cAMP levels. It plays an important role in many biological functions, such as cardiac rhythm and circulation, cerebral and renal blood flow, immune function, pain regulation, and sleep. It has been implicated in pathophysiological conditions such as inflammatory diseases and neurodegenerative disorders. Alternative splicing results in multiple transcript variants. A read-through transcript composed of the upstream SPECC1L (sperm antigen with calponin homology and coiled-coil domains 1-like) and ADORA2A (adenosine A2a receptor) gene sequence has been identified, but it is thought to be non-coding. (From NCBI)
Product OverviewMouse Anti-Rhesus ADORA2A Antibody is a mouse antibody against ADORA2A. It can be used for ADORA2A detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenosine receptor A2; ADORA2A
UniProt IDF6X9B3
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MDRELAQPASVLSLPVCGPIMGSSVYITVELAIAVLAILGNVLVCWAVWLNSNLQNVTNYFVVSLAAADIAVGVLAIPFAITISTGFCAACHGCLFIACFVLVLTQSSIFSLLAIAIDRYIAIRIPLRYNGLVTGTRAK.
For Research Use Only | Not For Clinical Use.
Online Inquiry