Mouse Anti-Rhesus ADORA3 Antibody (MO-AB-00950W)
Cat: MO-AB-00950W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO00950W |
Specificity | This antibody binds to Rhesus ADORA3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a protein that belongs to the family of adenosine receptors, which are G-protein-coupled receptors that are involved in a variety of intracellular signaling pathways and physiological functions. The receptor encoded by this gene mediates a sustained cardioprotective function during cardiac ischemia, it is involved in the inhibition of neutrophil degranulation in neutrophil-mediated tissue injury, it has been implicated in both neuroprotective and neurodegenerative effects, and it may also mediate both cell proliferation and cell death. Alternative splicing results in multiple transcript variants. This gene shares its 5' terminal exon with some transcripts from overlapping GeneID:57413, which encodes an immunoglobulin domain-containing protein. |
Product Overview | Mouse Anti-Rhesus ADORA3 Antibody is a mouse antibody against ADORA3. It can be used for ADORA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Adenosine receptor A3 isoform 2; ADORA3 |
UniProt ID | H9EY49 |
Protein Refseq | The length of the protein is 29 amino acids long. The sequence is show below: MPNNSTAPSLTDVTYITMEIFIGLCAIVG. |
See other products for " ADORA3 "
MO-AB-14099Y | Mouse Anti-Sheep ADORA3 Antibody (MO-AB-14099Y) |
MO-AB-34340W | Mouse Anti-Ferret ADORA3 Antibody (MO-AB-34340W) |
MO-AB-23984H | Mouse Anti-Rat Adora3 Antibody (MO-AB-23984H) |
CBMOAB-35236FYA | Mouse Anti-Rhesus ADORA3 Antibody (CBMOAB-35236FYA) |
MO-AB-23582R | Mouse Anti-Pig ADORA3 Antibody (MO-AB-23582R) |
MO-AB-28843W | Mouse Anti-Dog ADORA3 Antibody (MO-AB-28843W) |
MO-AB-07064R | Mouse Anti-Cattle ADORA3 Antibody (MO-AB-07064R) |
MO-AB-09566W | Mouse Anti-Cat ADORA3 Antibody (MO-AB-09566W) |
MO-AB-50515W | Mouse Anti-Marmoset ADORA3 Antibody (MO-AB-50515W) |
MO-AB-42906W | Mouse Anti-Hamsters ADORA3 Antibody (MO-AB-42906W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry