AibGenesis™ Mouse Anti-AGFG2 Antibody (MO-AB-03351W)


Cat: MO-AB-03351W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03351W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO03351W 100 µg
Inquiry
MO-AB-26174W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO26174W 100 µg
Inquiry
MO-AB-50583W Monoclonal Marmoset WB, ELISA MO50583W 100 µg
Inquiry

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO03351W
SpecificityThis antibody binds to Rhesus AGFG2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the HIV-1 Rev binding protein (HRB) family and encodes a protein with one Arf-GAP zinc finger domain, several phe-gly (FG) motifs, and four asn-pro-phe (NPF) motifs. This protein interacts with Eps15 homology (EH) domains and plays a role in the Rev export pathway, which mediates the nucleocytoplasmic transfer of proteins and RNAs. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. (From NCBI)
Product OverviewMouse Anti-Rhesus AGFG2 Antibody is a mouse antibody against AGFG2. It can be used for AGFG2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArfGAP With FG Repeats 2; Rev / Rex Activation Domain-Binding Protein Related; HIV-1 Rev-Binding Protein-Like Protein; HRBL; RABR; Arf-GAP Domain And FG Repeats-Containing Protein 2
UniProt IDG7MNU7
Protein RefseqThe length of the protein is 479 amino acids long.
The sequence is show below: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTSLVPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPAYTKGSASTPVQGSIPEGKPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQTAPAFAAFPAFGGQTPSHGGFANFDAFSSGPSPSVFGSLPPAGQAPFQAQPTPAGSSQGTPFGAVPLAPTSQPNSLTDVGSFLGPGVPTAGVPSSLFGMAGQVPPLQSVTMGSSSSTGLAFGAFTNPFAAPAAQPPLPSTNPFQPNGLAPGPGFGMSSAGPGFPQAVPPTGAFASSFPAPLFPPQTPLAQQQNGSSFGDLGSAKLGQRPLSQPVGISTNPFMTGPSSSPFASKPPTTNPFL.
For Research Use Only | Not For Clinical Use.
Online Inquiry