AibGenesis™ Mouse Anti-AMBN Antibody (CBMOAB-35575FYA)


Cat: CBMOAB-35575FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35575FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus) WB, ELISA MO35575FYA 100 µg
MO-AB-01384H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01384C 100 µg
MO-AB-07282R Monoclonal Cattle (Bos taurus) WB, ELISA MO07282R 100 µg
MO-AB-41218W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41218W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Frog (Xenopus laevis), Guinea pig (Cavia porcellus)
CloneMO35575FYA
SpecificityThis antibody binds to Rhesus AMBN.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the nonamelogenin enamel matrix protein ameloblastin. The encoded protein may be important in enamel matrix formation and mineralization. This gene is located in the calcium-binding phosphoprotein gene cluster on chromosome 4. Mutations in this gene may be associated with dentinogenesis imperfect and autosomal dominant amylogenesis imperfect. (From NCBI)
Product OverviewMouse Anti-Rhesus AMBN Antibody is a mouse antibody against AMBN. It can be used for AMBN detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAMBN
UniProt IDF7HLX7
Protein RefseqThe length of the protein is 447 amino acids long.
The sequence is show below: MSASKIPLFKMKDLILILCLLEMSFAVPFFPQQTGTPGMASLSLETMRQLGSLQGLNTLSQYSRFGFGKSLNSLWMHGLLPPHSSPPWMRPREHETQQYEYSLPVHPPPLPSQPSLKPQQPGLKPFLQAAAATADEATAQKEALRPPIHLGQLLLQEGELPLVQQQVAPSDKPPKPELPRMDFPDPQGPSLPRMDFPDPQGPSLPGLDFPDPQGPSIFQIARLISRGPMPQNKQSPLYPGMFYMPFGANQLNAPARLGIMSSEEMAGGRGDPMAYEAIFPGFGGMRSSLGGMPHKPAMGGDFTLEFDSPVAATKGPEKGEGGAQGSPMPEANPDDPENPAFLTELEPVAHAGLLALPKDDVPSLPRSPSGKMKGLPSVTPAGADPLMTPELADVYRTYDADMTTSVDFQDEVTMDTTMAPNSLQTSIPGNRAQEPEMMYDAWHFQEP.
For Research Use Only | Not For Clinical Use.
Online Inquiry