Mouse Anti-Rhesus AMBP Antibody (CBMOAB-35576FYA)


Cat: CBMOAB-35576FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35576FYA
SpecificityThis antibody binds to Rhesus AMBP.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a complex glycoprotein secreted in plasma. The precursor is proteolytically processed into distinct functioning proteins: alpha-1-microglobulin, which belongs to the superfamily of lipocalin transport proteins and may play a role in the regulation of inflammatory processes, and bikunin, which is a urinary trypsin inhibitor belonging to the superfamily of Kunitz-type protease inhibitors and plays an important role in many physiological and pathological processes. This gene is located on chromosome 9 in a cluster of lipocalin genes.
Product OverviewMouse Anti-Rhesus AMBP Antibody is a mouse antibody against AMBP. It can be used for AMBP detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAMBP
UniProt IDF6UQI4
Protein RefseqThe length of the protein is 341 amino acids long.
The sequence is show below: MRSLGALLLLLSACLVVSAGPVPTPPDNIQVQENFNVSRIYGKWYNLAIGSTCPWLKKIMDRMTVSTLVLGEGTTEAEISMTSTRWRKGVCEEMSGAYEKTDTDGKFLYHKSSKWSGRHAHSLLCLKYLDVLSSPCLCNRSSHLAEMETLLQDFRVVAQGVGIPEDSIFTMADRGECVPGEQEPEPILIPRARRAVLPQEEEGSGGGRLVTDVTKKEDSCQLGHSAGPCMGMTSRYFYNGTSMACETFQYGGCMGNGNNFMTEKECLQTCRTVAACNLPIVRGPCRAFIQLWAFDAVKGKCVLFTYGGCQGNGNKFYSEKECREYCGVPGDGDEELLRFSN.
See other products for " AMBP "
MOFY-0622-FY73Rabbit Anti-AMBP Antibody (MOFY-0622-FY73)
MO-AB-07283RMouse Anti-Cattle AMBP Antibody (MO-AB-07283R)
CBMOAB-65627FYAMouse Anti-Zebrafish ambp Antibody (CBMOAB-65627FYA)
MO-AB-10620YMouse Anti-O. mykiss Ambp Antibody (MO-AB-10620Y)
MO-AB-01386HMouse Anti-Frog ambp Antibody (MO-AB-01386H)
MO-AB-08279WMouse Anti-Cat AMBP Antibody (MO-AB-08279W)
MO-AB-23693RMouse Anti-Pig AMBP Antibody (MO-AB-23693R)
MOFAB-025WRabbit Anti-AMBP Antibody (MOFAB-025W)
For Research Use Only | Not For Clinical Use.
Online Inquiry