Mouse Anti-Rhesus AMOT Antibody (MO-AB-01025W)


Cat: MO-AB-01025W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01025W
SpecificityThis antibody binds to Rhesus AMOT.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternative splicing results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus AMOT Antibody is a mouse antibody against AMOT. It can be used for AMOT detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAngiomotin isoform 2; AMOT
UniProt IDH9F338
Protein RefseqThe length of the protein is 125 amino acids long.
The sequence is show below: AAAAAAAAAVQVAPAAPAPVPAPALVPVPASAAAQASAPAQTQAPTSATAAAPTPAPTPTPAVAQAEVPASPATGPGPHRLSIPSLTCNPDKADGPVFHSNTLERKTPIQILGQEPDAEMVEYLI.
For Research Use Only | Not For Clinical Use.
Online Inquiry