AibGenesis™ Mouse Anti-AP3S1 Antibody (CBMOAB-35943FYA)


Cat: CBMOAB-35943FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-35943FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO35943FYA 100 µg
CBMOAB-66063FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO66063FYA 100 µg
MO-AB-01470H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01470C 100 µg
MO-AB-07451R Monoclonal Cattle (Bos taurus) WB, ELISA MO07451R 100 µg
MO-AB-10637Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10637Y 100 µg
MO-AB-18807W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO18807W 100 µg
MO-AB-24089H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24089C 100 µg
MO-AB-51031W Monoclonal Marmoset WB, ELISA MO51031W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO35943FYA
SpecificityThis antibody binds to Rhesus AP3S1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a subunit of the AP3 adaptor complex. This complex functions in the formation of subcellular vesicles budded from the Golgi body. Several related pseudogenes of this gene have been found. Alternative splicing results in multiple transcript variants encoding different isoforms. (From NCBI)
Product OverviewMouse Anti-Rhesus AP3S1 Antibody is a mouse antibody against AP3S1. It can be used for AP3S1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAP3S1
UniProt IDF7CIN0
Protein RefseqThe length of the protein is 157 amino acids long.
The sequence is show below: MIKAILIFNNHGKPRLSKFYQPYSEDTQQQIIRETFHLVSKRDENVCNFLEGGLLIGGSDNKLIYRHYATLYFVFCVDSSESELGILDLIQVFVETLDKCFENVCELDLIFHVDKAGLAGAPARAVSAVKNMNLPEIPRNINIGDISIKVPNLPSFK.
For Research Use Only | Not For Clinical Use.
Online Inquiry