Mouse Anti-Rhesus APH1B Antibody (CBMOAB-35993FYA)


Cat: CBMOAB-35993FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO35993FYA
SpecificityThis antibody binds to Rhesus APH1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane; Endoplasmic reticulum; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a multi-pass transmembrane protein that is a functional component of the gamma-secretase complex, which also contains presenilin and nicastrin. This protein represents a stabilizing cofactor for the presenilin holoprotein in the complex. The gamma-secretase complex catalyzes the cleavage of integral proteins such as notch receptors and beta-amyloid precursor protein.
Product OverviewMouse Anti-Rhesus APH1B Antibody is a mouse antibody against APH1B. It can be used for APH1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAPH1B
UniProt IDF7DK04
Protein RefseqThe length of the protein is 257 amino acids long.
The sequence is show below: MTAAVFFGCAFIAFGPALALYVFTIATDPLRVIFLIAGSFFWLVSLLISSLVWFMARVITDNKDGPTQKYLLIFGAFVSVYIQKMFRFAYYRLLKKASEGLKSINPGETAPSMRLLAYVSGLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLYSAFMTLVIILLHVFWGIVFFDGCEKKKWCLLLIVLLTHLLVSAQTFISSYYGINLVSAFIILVLMGTWAFFVAGGSCRSLKLCLLCQDKDFLLYNQRSR.
For Research Use Only | Not For Clinical Use.
Online Inquiry