Mouse Anti-Rhesus AQP3 Antibody (CBMOAB-36098FYA)


Cat: CBMOAB-36098FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36098FYA
SpecificityThis antibody binds to Rhesus AQP3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes the water channel protein aquaporin 3. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein, also known as aquaporin 0. Aquaporin 3 is localized at the basal lateral membranes of collecting duct cells in the kidney. In addition to its water channel function, aquaporin 3 has been found to facilitate the transport of nonionic small solutes such as urea and glycerol, but to a smaller degree. It has been suggested that water channels can be functionally heterogeneous and possess water and solute permeation mechanisms. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
Product OverviewMouse Anti-Rhesus AQP3 Antibody is a mouse antibody against AQP3. It can be used for AQP3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAQP3
UniProt IDF7H7R3
Protein RefseqThe length of the protein is 203 amino acids long.
The sequence is show below: MGRQKELMSRCGEMLHIRHRLLRQALAECLGTLILVMFGCGSVAQVVLSRGTHGGFLTINLAFGFAVTLGILIAGQVSGAHLNPAVTFAMCFLAREPWIKLPVYTLAQTLGAFLGAGIVFGLYYDAIWGFADNQLFVSGPNGTAGIFATYPSGHLDMINGFFDQDRPALVVGAHRVPTPGLHCGCLRVPADDRLPPGAASTLH.
For Research Use Only | Not For Clinical Use.
Online Inquiry