AibGenesis™ Mouse Anti-ARHGAP17 Antibody (MO-AB-03383W)


Cat: MO-AB-03383W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-03383W Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset WB, ELISA MO03383W 100 µg
MO-AB-19190W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19190W 100 µg
MO-AB-51176W Monoclonal Marmoset WB, ELISA MO51176W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset
CloneMO03383W
SpecificityThis antibody binds to Rhesus ARHGAP17.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ARHGAP17 Antibody is a mouse antibody against ARHGAP17. It can be used for ARHGAP17 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRho GTPase Activating Protein 17; Rho-Type GTPase-Activating Protein 17; RICH-1; RICH1; Neuron-Associated Developmentally Regulated Protein; RhoGAP Interacting With CIP4 Homologs Protein 1; RhoGAP Interacting With CIP4 Homologs 1; Rho GTPase-Activating Protein 17; MSTP038
UniProt IDF7CNY9
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: RAEKTEVLSEDLLQIERRLDTVRSVCHHSHKRLVACFQGQHGTDAEKRHKKLPLTALAQNMQEASTQLEDSLLGKMLETCGDAENQLALELSQHEVFVEKEIVDPLYGIAEVEIPNIQKQRKQLAKLVLDWDSVRAHCNQEHSISSFALVDLPKPFSFLKFSVGVVGVTSPLPFTQDQLAADMYNFMAKEGEYGKFFVTISGRKNQPLGLP.
For Research Use Only | Not For Clinical Use.
Online Inquiry