Mouse Anti-Rhesus ARHGAP9 Antibody (MO-AB-01123W)


Cat: MO-AB-01123W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01123W
SpecificityThis antibody binds to Rhesus ARHGAP9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the Rho-GAP family of GTPase activating proteins. The protein has substantial GAP activity towards several Rho-family GTPases in vitro, converting them to an inactive GDP-bound state. It is implicated in regulating adhesion of hematopoietic cells to the extracellular matrix. Multiple transcript variants encoding different isoforms have been found for this gene. (From NCBI)
Product OverviewMouse Anti-Rhesus ARHGAP9 Antibody is a mouse antibody against ARHGAP9. It can be used for ARHGAP9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesRho GTPase-activating protein 9 isoform 1; ARHGAP9
UniProt IDH9FIE4
Protein RefseqThe length of the protein is 130 amino acids long.
The sequence is show below: GRLDLDSTEWDDIHVVTGALKLFLRELPQPLVPPLLLPHFRAALALSESEQCLSQIQELIGSMPKPNRDTLRYLLEHLCRVIAHSDKNRMTPHNLGIVFGPTLFRPEQETSDPAAHALYPGQLVQLMLTN.
For Research Use Only | Not For Clinical Use.
Online Inquiry