AibGenesis™ Mouse Anti-ARL6IP1 Antibody (CBMOAB-36262FYA)
Cat: CBMOAB-36262FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-36262FYA | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) | WB, ELISA | MO36262FYA | 100 µg | ||
| CBMOAB-66532FYA | Monoclonal | Zebrafish (Danio rerio) | WB, ELISA | MO66532FYA | 100 µg | ||
| MO-AB-01590H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01590C | 100 µg | ||
| MO-AB-07600R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO07600R | 100 µg | ||
| MO-AB-11652W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11652W | 100 µg | ||
| MO-AB-14248Y | Monoclonal | Sheep (Ovis aries) | WB, ELISA | MO14248Y | 100 µg | ||
| MO-AB-23866R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO23866R | 100 µg | ||
| MO-AB-24169H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24169C | 100 µg | ||
| MO-AB-36706W | Monoclonal | Goat (Capra hircus) | WB, ELISA | MO36706W | 100 µg | ||
| MO-AB-43721W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43721W | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Goat (Capra hircus), Horse (Equus caballus), Pig (Sus scrofa), Rat (Rattus norvegicus), Sheep (Ovis aries), Zebrafish (Danio rerio) |
| Clone | MO36262FYA |
| Specificity | This antibody binds to Rhesus ARL6IP1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Endoplasmic reticulum; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene. (From NCBI) |
| Product Overview | Mouse Anti-Rhesus ARL6IP1 Antibody is a mouse antibody against ARL6IP1. It can be used for ARL6IP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | ARL6IP1 |
| UniProt ID | F6X0N0 |
| Protein Refseq | The length of the protein is 203 amino acids long. The sequence is show below: MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDASVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGIISKYIGMAKREINKLLKQKEKKNE. |
For Research Use Only | Not For Clinical Use.
Online Inquiry