AibGenesis™ Mouse Anti-ARSD Antibody (CBMOAB-36318FYA)


Cat: CBMOAB-36318FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36318FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis) WB, ELISA MO36318FYA 100 µg
MO-AB-01625H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01625C 100 µg
MO-AB-22945W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22945W 100 µg
MO-AB-29035W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29035W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Dog (Canis lupus familiaris), Frog (Xenopus laevis)
CloneMO36318FYA
SpecificityThis antibody binds to Rhesus ARSD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is a member of the sulfatase family. Sulfatases are essential for the correct composition of bone and cartilage matrix. The encoded protein is postranslationally glycosylated and localized to the lysosome. This gene is located within a cluster of similar arylsulfatase genes on chromosome X. A related pseudogene has been identified in the pseudoautosomal region of chromosome Y. (From NCBI)
Product OverviewMouse Anti-Rhesus ARSD Antibody is a mouse antibody against ARSD. It can be used for ARSD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesARSD
UniProt IDH9H4P4
Protein RefseqThe length of the protein is 488 amino acids long.
The sequence is show below: TGMEASNGYRALQWNAGSGGLPENETTFARILQQRGYATGLIGKWHQGVNCASRGDHCHHPLNHGFDYFYGMPFTLTNDCDPGRPPEVDAALRAQLWGYTQFLALGILTVAAGKTCGFISVSGRVVTGMACMLFLFFISWYSSFGFVRRWNCVLMRNHDVTEQPMVLEKTASLMLKEAVSYIERHKHGPFLLFLSLLHVHIPLYTKPSFAPTTVGTSASDTFQFTAVFKVCIFRVTDDHAVYIILTFSAFSDHNTILEILLWLCLGGWGWLPQCGKGMGGWEGGIRVPGIFHWPGVLPAGRVIGEPTSLMDVFPTVVQLAGGEVPQDRVIDGHSLVPLLQGAEARSAHEFLFHYCGQHLHAARWHQRDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRHTLSPVPQQFSTSNILWKPWLQPCCGHFPFCSCHEDGDGTP.
For Research Use Only | Not For Clinical Use.
Online Inquiry