Mouse Anti-Rhesus ASL Antibody (MO-AB-01163W)


Cat: MO-AB-01163W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01163W
SpecificityThis antibody binds to Rhesus ASL.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the lyase 1 family. The encoded protein forms a cytosolic homotetramer and primarily catalyzes the reversible hydrolytic cleavage of argininosuccinate into arginine and fumarate, an essential step in the liver in detoxifying ammonia via the urea cycle. Mutations in this gene result in the autosomal recessive disorder argininosuccinic aciduria, or argininosuccinic acid lyase deficiency. A nontranscribed pseudogene is also located on the long arm of chromosome 22. Alternatively spliced transcript variants encoding different isoforms have been described.
Product OverviewMouse Anti-Rhesus ASL Antibody is a mouse antibody against ASL. It can be used for ASL detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArgininosuccinate lyase isoform 1; ASL
UniProt IDI0FKG1
Protein RefseqThe length of the protein is 464 amino acids long.
The sequence is show below: MASESGKLWGGRFVGAVDPIMEKFNTSIAYDRHLWEVDVQGSKAYSRGLEKAGLLTKAEMDQILHGLDKVAEEWAQGTFKLSPNDEDIHTANERRLKELIGETAGKLHTGRSRNDQVVTDLRLWMRQTCSTLSGLLWELIRTMVDRAEAERDVLFPGYTHLQRAQPIRWSHWILSHAVALTRDSERLLEVRKRINVLPLGSGAIAGNPLSVDRELLRAELNFGAITLNSMDATSERDFVAEFLFWASLCMTHLSRMAEDLILYCTKEFSFVQLSDAYSTGSSLMPQKKNPDSLELIRSKAGRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMSAVLQVATGVISTLQIHRENMGQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVFMAETKGVALNELSLQELQTISPLFSGDVSCVWDYGHSVEQYGALGGTARSSVDWQIRQVRALLQTQQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry