AibGenesis™ Mouse Anti-ATP6V0E2 Antibody (MO-AB-01206W)


Cat: MO-AB-01206W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-01206W Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus) WB, ELISA MO01206W 100 µg
MO-AB-01744H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01744C 100 µg
MO-AB-07312Y Monoclonal Rabbit (Oryctolagus cuniculus) WB, ELISA MO07312Y 100 µg
MO-AB-07846R Monoclonal Cattle (Bos taurus) WB, ELISA MO07846R 100 µg
MO-AB-22835W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO22835W 100 µg
MO-AB-24253H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24253C 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Rabbit (Oryctolagus cuniculus), Rat (Rattus norvegicus)
CloneMO01206W
SpecificityThis antibody binds to Rhesus ATP6V0E2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus ATP6V0E2 Antibody is a mouse antibody against ATP6V0E2. It can be used for ATP6V0E2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesV-type proton ATPase subunit e 2 isoform 1; ATP6V0E2
UniProt IDH9F3G2
Protein RefseqThe length of the protein is 129 amino acids long.
The sequence is show below: RVRGPARLIALGARLLLRMLSALPGRGPTHLQRPLLGPASHLGILRPAMTAHSFALPVIIFTTFWGLIGIAGPWFVPKGPNRGVIITMLVATAVCCYLFWLIAILAQLNPLFGPQLKNETIWYVRFLWE.
For Research Use Only | Not For Clinical Use.
Online Inquiry