Mouse Anti-Rhesus ATP6V1G2 Antibody (CBMOAB-36603FYA)
Cat: CBMOAB-36603FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta) |
| Clone | MO36603FYA |
| Specificity | This antibody binds to Rhesus ATP6V1G2. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is one of three V1 domain G subunit proteins. This gene had previous gene symbols of ATP6G and ATP6G2. Alternatively spliced transcript variants encoding different isoforms have been described. Read-through transcription also exists between this gene and the downstream DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B (DDX39B) gene. |
| Product Overview | Mouse Anti-Rhesus ATP6V1G2 Antibody is a mouse antibody against ATP6V1G2. It can be used for ATP6V1G2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | V-type proton ATPase subunit G 2; ATP6V1G2 |
| UniProt ID | F7EWD0 |
| Protein Refseq | The length of the protein is 196 amino acids long. The sequence is show below: MAENDVDNELLDYEDDEVETAAGGDGAEAPAKKDVKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQLEPVTGQVCFCSHFPRGNDEGLHSWYVSVYFLPKVSVLVMCHTRELAFQISKEYERFSKYMPNVKVAVFFGGLSIKKDEEVLKKNCPHIV. |
See other products for " ATP6V1G2 "
| MO-AB-51603W | Mouse Anti-Marmoset ATP6V1G2 Antibody (MO-AB-51603W) |
| MO-AB-24005R | Mouse Anti-Pig ATP6V1G2 Antibody (MO-AB-24005R) |
| MO-AB-06326Y | Mouse Anti-O. anatinus Atp6v1g2 Antibody (MO-AB-06326Y) |
| MO-AB-24261H | Mouse Anti-Rat Atp6v1g2 Antibody (MO-AB-24261H) |
| MO-AB-13769W | Mouse Anti-Chimpanzee ATP6V1G2 Antibody (MO-AB-13769W) |
| MO-AB-14320Y | Mouse Anti-Sheep ATP6V1G2 Antibody (MO-AB-14320Y) |
| MO-AB-07861R | Mouse Anti-Cattle ATP6V1G2 Antibody (MO-AB-07861R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry