Mouse Anti-Rhesus ATP7B Antibody (MO-AB-01211W)
Cat: MO-AB-01211W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rhesus (Macaca mulatta) |
Clone | MO01211W |
Specificity | This antibody binds to Rhesus ATP7B. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD). |
Product Overview | Mouse Anti-Rhesus ATP7B Antibody is a mouse antibody against ATP7B. It can be used for ATP7B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Copper-transporting ATPase 2 isoform a; ATP7B |
UniProt ID | H9FH99 |
Protein Refseq | The length of the protein is 84 amino acids long. The sequence is show below: SLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPLIIIMSTLTLVV. |
See other products for " ATP7B "
MO-AB-24014R | Mouse Anti-Pig ATP7B Antibody (MO-AB-24014R) |
MO-AB-51607W | Mouse Anti-Marmoset ATP7B Antibody (MO-AB-51607W) |
MO-AB-29176W | Mouse Anti-Dog ATP7B Antibody (MO-AB-29176W) |
CBMOAB-36617FYA | Mouse Anti-Rhesus ATP7B Antibody (CBMOAB-36617FYA) |
MO-AB-14321Y | Mouse Anti-Sheep ATP7B Antibody (MO-AB-14321Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry