Mouse Anti-Rhesus ATP7B Antibody (MO-AB-01211W)


Cat: MO-AB-01211W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01211W
SpecificityThis antibody binds to Rhesus ATP7B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene is a member of the P-type cation transport ATPase family and encodes a protein with several membrane-spanning domains, an ATPase consensus sequence, a hinge domain, a phosphorylation site, and at least 2 putative copper-binding sites. This protein functions as a monomer, exporting copper out of the cells, such as the efflux of hepatic copper into the bile. Alternate transcriptional splice variants, encoding different isoforms with distinct cellular localizations, have been characterized. Mutations in this gene have been associated with Wilson disease (WD).
Product OverviewMouse Anti-Rhesus ATP7B Antibody is a mouse antibody against ATP7B. It can be used for ATP7B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCopper-transporting ATPase 2 isoform a; ATP7B
UniProt IDH9FH99
Protein RefseqThe length of the protein is 84 amino acids long.
The sequence is show below: SLITGEAMPVTKKPGSTVIAGSINAHGSVLIKATHVGNDTTLAQIVKLVEEAQMSKAPIQQLADRFSGYFVPLIIIMSTLTLVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry