AibGenesis™ Mouse Anti-AURKAIP1 Antibody (CBMOAB-36656FYA)


Cat: CBMOAB-36656FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36656FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, ELISA MO36656FYA 100 µg
CBMOAB-67238FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO67238FYA 100 µg
MO-AB-01769H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01769C 100 µg
MO-AB-07901R Monoclonal Cattle (Bos taurus) WB, ELISA MO07901R 100 µg
MO-AB-19941W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO19941W 100 µg
MO-AB-24279H Monoclonal Rat (Rattus norvegicus) WB, ELISA MO24279C 100 µg
MO-AB-51649W Monoclonal Marmoset WB, ELISA MO51649W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Marmoset, Rat (Rattus norvegicus), Zebrafish (Danio rerio)
CloneMO36656FYA
SpecificityThis antibody binds to Rhesus AURKAIP1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus AURKAIP1 Antibody is a mouse antibody against AURKAIP1. It can be used for AURKAIP1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAurora kinase A-interacting protein; AURKAIP1
UniProt IDH9FWC6
Protein RefseqThe length of the protein is 199 amino acids long.
The sequence is show below: MLLGRLTSQLLRAVPWAGGRPPWPVSGVLGSRACGPLYSTRPAGPGRAASLPRKGAQLELEEMLVPRKMCVSPLESWLTARCFLPRLDSGTAGPVAPPQSHHCPPSPIGEGAEQGDEGVGDAPQIQCKNVLKIRRRKMNRHKYRKLVKRTRFLRRKIREGRLKRKQIKFEKDLRRIWLKAGLKEAPEGWQTPNIYLRSK.
For Research Use Only | Not For Clinical Use.
Online Inquiry