AibGenesis™ Mouse Anti-BASE Antibody (CBMOAB-36776FYA)


Cat: CBMOAB-36776FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-36776FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO36776FYA 100 µg
MO-AB-07970R Monoclonal Cattle (Bos taurus) WB, ELISA MO07970R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO36776FYA
SpecificityThis antibody binds to Rhesus BASE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus BASE Antibody is a mouse antibody against BASE. It can be used for BASE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBASE; BASE
UniProt IDQ2KKI5
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MLNVSGFFILLCGLLASSSAQEVLAGVSSQLLNDLTQGLLRADFLPSLQTISLQKSLSSAFDVVSGLLDILGPPLTNEIDTVRIQVKNPQLLQVSIESTPQRKEATVRVPFISELIAQLLTLKPFTANMQSDIKVQIRLEKNVGGRYELAFGNCRLLPEAIWIQTGAQLAPAAKFVVANIERNLKNIVAHDMGQKVCPVINKWLYNLEQHVVKELINLVLLQEKYQVTI.
For Research Use Only | Not For Clinical Use.
Online Inquiry