Mouse Anti-Rhesus BID Antibody (CBMOAB-36973FYA)


Cat: CBMOAB-36973FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO36973FYA
SpecificityThis antibody binds to Rhesus BID.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationMitochondrion; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a death agonist that heterodimerizes with either agonist BAX or antagonist BCL2. The encoded protein is a member of the BCL-2 family of cell death regulators. It is a mediator of mitochondrial damage induced by caspase-8 (CASP8); CASP8 cleaves this encoded protein, and the COOH-terminal part translocates to mitochondria where it triggers cytochrome c release. Multiple alternatively spliced transcript variants have been found, but the full-length nature of some variants has not been defined.
Product OverviewMouse Anti-Rhesus BID Antibody is a mouse antibody against BID. It can be used for BID detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBID
UniProt IDF6WQU1
Protein RefseqThe length of the protein is 210 amino acids long.
The sequence is show below: SPLEHRELGVSRSCRAAQAMDCEVSNGSGLRDECVTNLLVFGFLQSCSDNSFRRELDALGRELPVPAAQWEAYDELQTDGNRSSHSRMGRIEAGRWPAPPPSPKPGFSVASYWAQPPRLQFQRPRRLLRNTSRSEEDRNRDLATALEQLLQAYPTDMEKEKTMLVLALLLAKKVASHTPSLLRDVFQTTVNFINQNLRAYVRSLARNGMD.
For Research Use Only | Not For Clinical Use.
Online Inquiry