AibGenesis™ Mouse Anti-BOLA3 Antibody (MO-AB-01317W)
Cat: MO-AB-01317W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-01317W | Monoclonal | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) | WB, ELISA | MO01317W | 100 µg | ||
| MO-AB-08506R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08506R | 100 µg | ||
| MO-AB-10752Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10752Y | 100 µg | ||
| MO-AB-11268W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO11268W | 100 µg | ||
| MO-AB-24409H | Monoclonal | Rat (Rattus norvegicus) | WB, ELISA | MO24409C | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), O. mykiss (Oncorhynchus mykiss), Rat (Rattus norvegicus) |
| Clone | MO01317W |
| Specificity | This antibody binds to Rhesus BOLA3. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a protein that plays an essential role in the production of iron-sulfur (Fe-S) clusters for the normal maturation of lipoate-containing 2-oxoacid dehydrogenases, and for the assembly of the mitochondrial respiratory chain complexes. Mutation in this gene has been associated with multiple mitochondrial dysfunctions syndrome-2. Two alternatively spliced transcript variants encoding different isoforms with distinct subcellular localization have been reported for this gene (PMID:21944046). (From NCBI) |
| Product Overview | Mouse Anti-Rhesus BOLA3 Antibody is a mouse antibody against BOLA3. It can be used for BOLA3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | BolA-like protein 3 isoform 1; BOLA3 |
| UniProt ID | H9FAZ9 |
| Protein Refseq | The length of the protein is 53 amino acids long. The sequence is show below: ISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR. |
For Research Use Only | Not For Clinical Use.
Online Inquiry