AibGenesis™ Mouse Anti-CATSPER1 Antibody (CBMOAB-38206FYA)


Cat: CBMOAB-38206FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38206FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Pig (Sus scrofa) WB, ELISA MO38206FYA 100 µg
MO-AB-09556R Monoclonal Cattle (Bos taurus) WB, ELISA MO09556R 100 µg
MO-AB-15223W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO15223W 100 µg
MO-AB-24341R Monoclonal Pig (Sus scrofa) WB, ELISA MO24341R 100 µg
MO-AB-36867W Monoclonal Goat (Capra hircus) WB, ELISA MO36867W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Goat (Capra hircus), Pig (Sus scrofa)
CloneMO38206FYA
SpecificityThis antibody binds to Rhesus CATSPER1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CATSPER1 Antibody is a mouse antibody against CATSPER1. It can be used for CATSPER1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSperm ion channel; CATSPER1
UniProt IDQ6TYQ6
Protein RefseqThe length of the protein is 390 amino acids long.
The sequence is show below: MDQNSVPEKAQNEADTNNTDTFFRSHSSPPHHRPGHSGALHHHGVPQRRGESHHPPEFEDFHDQAFSSHIHQSQHHSEAWNHGRAHGPTGFGLAPSEGAVPSHHSYGEDYLNELHHAGRRHHDGSQYSGFHQQNDSHSRKESHHGRRQYLGENLSHYSSGVPHHPSEASHHGGSYLPPGANPYSESFHHSEASYLSGLQHNESQHHQVSHHGWSTHHQSHHHGRSHHHEAHQHRRPSHHGQIISPYSSVGSYQHGISDHHSEYPHSEHSHHTQYHHRTHQHRDHHQHRDHHSTHHSSHQYRDYVQSTSQLSIPQTSWSLVHDASGPAASHTGASPHHMAHPQGSAHSMTRSVSTVPSRATQRSKKVHPWDTSTKDSEDWGKEEGRFQKRK.
For Research Use Only | Not For Clinical Use.
Online Inquiry