AibGenesis™ Mouse Anti-CATSPER4 Antibody (CBMOAB-38209FYA)


Cat: CBMOAB-38209FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38209FYA Monoclonal Rhesus (Macaca mulatta), Pig (Sus scrofa) WB, ELISA MO38209FYA 100 µg
MO-AB-24344R Monoclonal Pig (Sus scrofa) WB, ELISA MO24344R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Pig (Sus scrofa)
CloneMO38209FYA
SpecificityThis antibody binds to Rhesus CATSPER4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CATSPER4 Antibody is a mouse antibody against CATSPER4. It can be used for CATSPER4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCation channel sperm-associated protein 4; CATSPER4
UniProt IDH9FI89
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: FGAFVPKHFRNIQVALYTLFICITQDGWVDIYSDFQTEKREYAMEIGGAIYFTIFITIGAFIGINLFVIVVTTNLEQMMKAEEQGQQQRITFSETGAEEEEENDQLPLVHCVVARSEKSRFP.
For Research Use Only | Not For Clinical Use.
Online Inquiry