AibGenesis™ Mouse Anti-CATSPERD Antibody (CBMOAB-38212FYA)


Cat: CBMOAB-38212FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38212FYA Monoclonal Rhesus (Macaca mulatta), Cattle (Bos taurus) WB, ELISA MO38212FYA 100 µg
MO-AB-09557R Monoclonal Cattle (Bos taurus) WB, ELISA MO09557R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Cattle (Bos taurus)
CloneMO38212FYA
SpecificityThis antibody binds to Rhesus CATSPERD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CATSPERD Antibody is a mouse antibody against CATSPERD. It can be used for CATSPERD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCATSPERD
UniProt IDF6PU19
Protein RefseqThe length of the protein is 359 amino acids long.
The sequence is show below: MFRSSGILEILTPLRDTAFAAFDFQKCLLNIQAILMDPDLHVGRCNIEVLKGEFTYRMYTIDMHSQLELTALLIPQPGTSLIPLVMVSNPHSLGFQATFYESGYTSDGNTKYKLDIYLKQQQHWGRTDFNFTSSLKRATMSTLTVDIANKEISCVDIKPLSTLISVGCDLDKKIVIQKNGVSPCWPGWSQTKKLTRMGSFSIFWEFYDPGFQGRQSSKDLHVFYSYQQLGCPLLVYYDTPWKPVVELLECSGMNAVHCSLNLPGSSGPPASASQVAGTAGTHRHARLVLFFFFFFFLRRSLALLPRLECSGAISAHCKLRLPGSRHSPASASRVAGSTGAHRRAQLTFFVFFRDGVSPC.
For Research Use Only | Not For Clinical Use.
Online Inquiry