AibGenesis™ Mouse Anti-CC2D1B Antibody (CBMOAB-38262FYA)


Cat: CBMOAB-38262FYA

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-38262FYA Monoclonal Rhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio) WB, ELISA MO38262FYA 100 µg
CBMOAB-69254FYA Monoclonal Zebrafish (Danio rerio) WB, ELISA MO69254FYA 100 µg
MO-AB-20615W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO20615W 100 µg
MO-AB-52346W Monoclonal Marmoset WB, ELISA MO52346W 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta), Chimpanzee (Pan troglodytes), Marmoset, Zebrafish (Danio rerio)
CloneMO38262FYA
SpecificityThis antibody binds to Rhesus CC2D1B.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Rhesus CC2D1B Antibody is a mouse antibody against CC2D1B. It can be used for CC2D1B detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCC2D1B
UniProt IDF6Y5T3
Protein RefseqThe length of the protein is 214 amino acids long.
The sequence is show below: MLLEQQEKCLLFSKQFMHQGNVAETTRFEKLAQDRRKQLEILQLAQAQGLDPPSHHFELKTFQTVRIFSELNSTEMHLIIVRGMNLPAPPGVTPDDLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEFDQLFKLNINRNHRGFKRVIQSKGIKFEIFHKGSFFRSDKLVGTAHLKLERLENECEIREIVEMERFRRSEKSHRGTQQKAASLFP.
For Research Use Only | Not For Clinical Use.
Online Inquiry